PLoS ONE
Home Koala cathelicidin PhciCath5 has antimicrobial activity, including against Chlamydia pecorum
Koala cathelicidin PhciCath5 has antimicrobial activity, including against <i>Chlamydia pecorum</i>
Koala cathelicidin PhciCath5 has antimicrobial activity, including against Chlamydia pecorum

Competing Interests: M.K is a Principal Scientist at Zoetis Veterinary Medicines Research and Development facility, Kalamazoo MI, USA. This does not alter our adherence to PLOS ONE policies on sharing data and materials. The remaining authors declare no conflicts of interest.

Article Type: Research Article Article History
Abstract

Devastating fires in Australia over 2019–20 decimated native fauna and flora, including koalas. The resulting population bottleneck, combined with significant loss of habitat, increases the vulnerability of remaining koala populations to threats which include disease. Chlamydia is one disease which causes significant morbidity and mortality in koalas. The predominant pathogenic species, Chlamydia pecorum, causes severe ocular, urogenital and reproductive tract disease. In marsupials, including the koala, gene expansions of an antimicrobial peptide family known as cathelicidins have enabled protection of immunologically naïve pouch young during early development. We propose that koala cathelicidins are active against Chlamydia and other bacteria and fungi. Here we describe ten koala cathelicidins, five of which contained full length coding sequences that were widely expressed in tissues throughout the body. Focusing on these five, we investigate their antimicrobial activity against two koala C. pecorum isolates from distinct serovars; MarsBar and IPTaLE, as well as other bacteria and fungi. One cathelicidin, PhciCath5, inactivated C. pecorum IPTaLE and MarsBar elementary bodies and significantly reduced the number of inclusions compared to the control (p<0.0001). Despite evidence of cathelicidin expression within tissues known to be infected by Chlamydia, natural PhciCath5 concentrations may be inadequate in vivo to prevent or control C. pecorum infections in koalas. PhciCath5 also displayed antimicrobial activity against fungi and Gram negative and positive bacteria, including methicillin-resistant Staphylococcus aureus (MRSA). Electrostatic interactions likely drive PhciCath5 adherence to the pathogen cell membrane, followed by membrane permeabilisation leading to cell death. Activity against E. coli was reduced in the presence of 10% serum and 20% whole blood. Future modification of the PhciCath5 peptide to enhance activity, including in the presence of serum/blood, may provide a novel solution to Chlamydia infection in koalas and other species.

Peel,Cheng,Djordjevic,O’Meally,Thomas,Kuhn,Sorrell,Huston,Belov,and Murthy: Koala cathelicidin PhciCath5 has antimicrobial activity, including against Chlamydia pecorum

Introduction

The koala (Phascolarctos cinereus) is an iconic Australian marsupial and the last surviving member of the Phascolarctidae. Marsupials are one of three mammalian lineages, the others being eutherian mammals such as humans, and monotremes such as the platypus. Marsupials differ from other mammals in a number of key anatomical and physiological traits, many of which are involved in reproduction and development [1]. Koalas are mostly arboreal marsupials that subsist on a strict diet of Eucalyptus leaves [1]. Typical of marsupials, koalas have a short gestation period of up to 35 days and give birth to altricial young that remain in the pouch for 9 months [1].

Fires devastated large swathes of Australia in 2019–20, burning through at least 11 million hectares (1.1x1011 m2), destroying crucial habitat of already vulnerable and threatened species, and driving many to the brink of extinction [2,3]. Estimates suggest nearly three billion animals were killed or impacted by the fires [4]. In response the Australian Government identified 119 priority species that require urgent management intervention, one of which was the koala [3]. Prior to this catastrophic event, koala populations were already in decline along the east coast of Australia due to multiple threats including habitat loss, climate change, and disease [5,6]. The 2019–20 fires further decimated these populations; with at least 3.5 million hectares(3.5 x 1010 m2), or 25%, of koala suitable habitat in eastern NSW affected by fire [7]. The resulting genetic bottleneck, combined with substantial habitat destruction by fire, leaves remaining populations especially vulnerable to new and existing threats including disease [5,8].

Three main diseases infect koalas; koala retrovirus [9], the fungus, Cryptococcus [10], and the bacterium Chlamydia [5]. Chlamydiosis, the disease resulting from Chlamydia infection, is a major contributing factor to the decline and long-term viability of koala populations [5]. Chlamydia are intracellular, Gram-negative bacteria which infect a wide range of hosts including humans, livestock, and wildlife [11]. They have a bi-phasic life cycle consisting of an intracellular reticulate body that is metabolically active and replicates within the host cell, and an infectious elementary body (EB) that is released into the extracellular environment following host cell rupture. Chlamydia pecorum is principally responsible for chlamydiosis in koalas, and causes both mild and severe disease [6,12]. Clinical manifestations include ocular disease leading to blindness, urogenital disease resulting in cystitis and infertility, and respiratory disease [5]. The prevalence of infection varies, but is as high as 90% in koala populations in Queensland, New South Wales, and Victoria [5,6].

Substantial research over the past decade has culminated in a promising C. pecorum vaccine for koalas (reviewed in [13]). However, limitations remain regarding long-term protection against reinfection [14], hence research is ongoing and treatment remains an essential component of the response to chlamydiosis in koalas. Treating chlamydiosis in koalas can be difficult as macrolide and tetracycline antibiotics commonly used in humans cause gastrointestinal dysbiosis, which can be fatal [15,16]. Chloramphenicol and enrofloxacin are commonly used, and pharmacokinetic studies have aided in developing koala-specific dosage regimes [1719]. However, koalas continue to shed the pathogen after treatment with enrofloxacin [20]. Chloramphenicol is the mainstay of current treatment regimens, although adverse side-effects have been observed [19,21]. Use of chloramphenicol is further confounded by its decreasing availability [6], driving the search for alternative antibiotics.

Florfenicol, a derivative of chloramphenicol, has yielded mixed results as the highest tolerated dose produced suboptimal plasma concentrations, and the majority of infections required additional treatments or did not resolve [22]. Doxycycline effectively cleared the infection, but only a single study of five koalas has been conducted [23]. Natural innate defence mechanisms of the koala, including antimicrobial peptides (AMPs), may play a role in reducing chlamydial infection and provide avenues for new treatment options in the future.

There are two main families of AMPs in mammals; cathelicidins and defensins [24]. Cathelicidins are small, cationic antimicrobial peptides expressed within neutrophils and epithelial cells, and are features of the innate immune system [24]. They have both immunomodulatory and antimicrobial functions, and display activity against a range of bacteria, fungi and viruses [24]. Throughout evolution cathelicidins have expanded in marsupials, compared to eutherian mammals, resulting in numerous diverse peptides [2528]. For example, the gray short-tailed opossum has 19 cathelicidin genes [27,28], while humans have only one [29]. Expansions within marsupials are likely driven by the need to protect immunologically naive young during pouch life [25,30]. Marsupials have a very short gestation period of up to 35 days and give birth to altricial young which are immunologically naïve at birth [1,31]. During immunological development the young encounter a diverse range of microbial flora within the pouch [32], and are protected by products of innate immune mechanisms such as cathelicidins expressed in the milk [30,33] and pouch lining [25,34]. Previous work has shown that tammar wallaby and Tasmanian devil cathelicidins have potent broad spectrum antimicrobial activity and kill drug resistant bacteria such as methicillin-resistant S. aureus (MRSA) [30] and multidrug-resistant isolates of Klebsiella pneumoniae, Pseudomonas aeruginosa and Acinetobacter baumannii [35]. However, activity against intracellular bacteria such as Chlamydia has not been tested. Cathelicidins from humans and livestock inactivated a number of Chlamydia species but were ineffective against C. pecorum [3639].

Our aim was to characterise cathelicidins in the koala genome [40] and transcriptomes [41,42], and determine the activity of five synthetic cathelicidins against two koala C. pecorum strains; IPTaLE and MarsBar, as well as other bacteria and fungi from humans and animals. To further understand the mechanism of antimicrobial activity, we assessed membrane permeabilisation and activity in the presence of inhibitors. The distribution of cathelicidin transcripts across a range of tissues was examined to determine if cathelicidins are present at the site of Chlamydia infection, and hence may be involved in natural defence against Chlamydia.

Methods

Bioinformatics

Koala cathelicidins were identified in the koala genome [40] and transcriptome [41,42] using BLAST with default parameters, and previously characterised marsupial, monotreme and eutherian cathelicidins as query sequences (S3 Table). Multiple sequence alignments of putative koala cathelicidins with sequences from other marsupial, monotreme and eutherian cathelicidins (S3 Table) were constructed using ClustalW [43] in BioEdit [44] to identify conserved peptide domains and motifs. Signal peptide sequences were predicted using SignalP 4.1 [45]. To examine phylogenetic relationships, amino acid alignments of full-length sequences, and cathelin domain only, were used to construct individual phylogenetic trees in MEGA7 [46] using the neighbour-joining method with p-distance, pairwise deletion and 500 bootstrap replicates, as well as maximum likelihood method, with the Jones Taylor-Thornton model and 500 bootstrap replicates. Both neighbour-joining and maximum likelihood methods produced the same tree topology for alignments of full-length sequences and cathelin domain only, hence only the maximum likelihood trees are displayed here.

Only full-length sequences with complete open reading frames were included in subsequent analyses. The relative transcription levels of full-length koala cathelicidins were examined in previously published liver, spleen, bone marrow, lymph, lung, kidney, testis, uterus, brain, salivary gland, adrenal gland, and mammary gland transcriptomes from one koala euthanized due to unsuccessful treatment for severe chlamydiosis and one koala euthanized due to dog attack [41,42]. RNAseq reads (SRR1106690, SRR1106707, SRR1121764, SRR1122141, SRR1203868, SRR1205138, SRR1205176, SRR1205218, SRR1205222-SRR1205224, SRR1205998, SRR1207974, SRR1207975, SRR3724381) were mapped against the koala assembly (GCF_002099425.1) using STAR [47] and abundance estimated using Stringtie [48] as transcripts per million (TPM).

Mature peptide cleavage sites were predicted using ExPasy peptide cutter (http://web.expasy.org/peptide_cutter/) with neutrophil elastase. Molecular weight of mature peptides and charge at pH 7 was calculated using Protein Calculator v3.4 (http://protcalc.sourceforge.net/, May 2013). Hydrophobicity percentage was calculated using Peptide 2.0 hydrophobicity/hydrophilicity analysis (http://peptide2.cpm/N_peptide_hydrophobicity_hydrophilicity.php, 2016). Kyte and Dolittle hydropathicity plots [49] and Deleage and Roux alpha helicity plots [50], both with a window size of n = 7, were created using ProtScale through the ExPasy server [51]. Grand average of hydropathicity (GRAVY) scores were calculated using ProtParam through the ExPasy server [51]. Mature peptide amino acid similarity scores were calculated in BioEdit [44] using the BLOSUM62 matrix. Mature peptides were synthesised by ChinaPeptides Co. Ltd. to >95% purity.

Antimicrobial susceptibility

Antimicrobial activity was determined against a range of bacteria and fungi from humans and animals using a broth microdilution susceptibility assay according to clinical laboratory standards institute (CLSI) guidelines in 96 well polypropylene plates as described previously [30]. Bacterial and fungal isolates tested are summarised in Table 2. Briefly, cathelicidins were dissolved in DMSO and serially diluted, in cation-adjusted Mueller Hinton Broth (MH II B) with or without 10% lysed horse blood for bacteria, and yeast nitrogen base (YNB) for fungi. Cathelicidin concentrations ranged between 64μg/mL and 0.125μg/mL in a final volume of 100μL. For all bacteria and fungi tested, ampicillin, tetracycline and fluconazole were included as positive controls, in addition to a media-only control and growth control (no inhibitor). Bacteria and fungi were sub-cultured 20–24 hours prior to the test, suspended in saline and their concentration adjusted to a 0.5 McFarland standard. Microorganisms were then diluted to a concentration of 0.5–1.0x106 cells/mL, with colony counts performed to confirm microorganism density, and 100μL was dispensed into the wells of the cathelicidin dilution plate. All plates were incubated at 35°C for 20–48 hours depending on the strain. Antimicrobial activity was expressed as minimum inhibitory concentration (MIC), which was defined as the lowest concentration of cathelicidin preventing visible bacterial growth, relative to the no-drug control. The same microdilution susceptibility assay was performed using Mueller Hinton Broth without the addition of the divalent cations calcium and magnesium (MHB), to test the effect of the cations on PhciCath5 activity against the ATCC strains E. coli 25922 and S. aureus 29213.

Effect of serum and blood on antibacterial activity

The potential inhibitory effect of serum and blood on PhciCath5 antibacterial activity was investigated using a broth microdilution susceptibility assay as described above with the following modifications. This assay was performed in collaboration with Zoetis Veterinary Medicine Research and Development. PhciCath5 was solubilized in water for cell culture containing 0.01% acetic acid and serial two-fold dilutions were prepared from 50mM to 0.78mM. E. coli ATCC25922 was sub-cultured onto sheep blood agar (SAB) and incubated at 35°C for 24 hours prior to the test. Colonies were suspended in saline and the concentration adjusted to a 0.5 McFarland standard. The bacterial suspension was then diluted 1/250 with MHB containing 10% bovine serum albumin (BSA) or 20% whole mouse blood (BioIVT). The cathelicidin serial dilutions were further diluted 1/10 with bacterial suspension in a 96-well polypropylene plate, to give a final cathelicidin concentration ranging between 50 and 0.78μM. A growth control (no inhibitor) was also included. The plates were incubated for 24 hours at 37°C and the MIC recorded as the lowest concentration of cathelicidin preventing visible bacterial growth, relative to the no-drug control.

Bacterial membrane permeability

Membrane permeabilisation of E. coli ATCC25922 by PhciCath5 was assessed using the Promega CellTox green cytotoxicity assay. E.coli ATCC25922 was sub-cultured onto TSA II blood agar and incubated at 35oc for 24 hours prior to the test. A bacterial suspension was prepared in RPMI to give an OD600 reading of 0.2. PhciCath5 was dissolved in water for cell culture containing 0.01% acetic acid and serial two-fold dilutions prepared in a black 384-well polypropylene plate. The plate was then innoculated with E. coli ATCC25922, producing a total well volume of 30uL and final peptide concentration of 50 to 0.05uM. Fluorescence was then measured at 512nm using the Perkin Elmer Envision multilabel plate reader (0 hours). The plate was then incubated at room temperature and additional fluorescence measurements were recorded at 1, 2, 3 and 4hrs. Membrane permeability was calculated as a percentage relative to the “no inhibitor” control. PhciCath5 concentration which resulted in greater than or equal to 5% E. coli ATCC25922 membrane permeability was reported.

Chlamydia pecorum antimicrobial susceptibility

C. pecorum IPTaLE and MarsBar [11,52] were cultured in mouse McCoy B cells, on DMEM supplemented with 10% foetal calf serum (FCS), 0.1mg/mL streptomycin and 0.05mg/mL gentamicin at 37°C in a 5% CO2 atmosphere. Cell lines were routinely tested for mycoplasma contamination every 2 months. Prior to performing antimicrobial susceptibility assays, 96-well plates were seeded with 30,000 host cells per well 24 hours prior to chlamydial infection as described previously [53,54]. For the antimicrobial assays, koala cathelicidin mature peptides, PhciCath1, 2, 3, 5 and 6, were solubilized in water for cell culture with 0.01% acetic acid, and two-fold dilutions were made in sucrose-phosphate-glutamic acid (SPG) media from 1mg to 250μg/mL, in triplicate. Cathelicidin containing wells were diluted one in two with C. pecorum IPTaLE and MarsBar EBs and incubated for 2 hours at 37°C, giving a final cathelicidin concentration of 500, 250 and 125μg/mL. A negative SPG only control was included. To exclude the possibility of cathelicidin toxicity to McCoy cells, cathelicidin dilutions were removed by centrifugation and C. pecorum EBs re-suspended in DMEM supplemented with 10% FCS, 0.1mg/mL streptomycin and 0.05mg/mL gentamycin. The suspension was used to infect a McCoy B ATCC CRL-1696 cell monolayer at a Multiplicity of Infection (MOI) of 0.6 as described previously [53,54]. At 44 hours post infection, host cells were lysed by vigorous pipetting and Chlamydia harvested by centrifugation. Following one freeze-thaw passage of the supernatant, Chlamydia were serially diluted onto fresh McCoy cell monolayers, and fixed and stained at 40hrs post infection for enumeration of Chlamydia inclusion forming units (IFU) per mL. This approach involving two rounds of infection essentially provides the minimum chlamydicidal concentration, or the minimum concentration of cathelicidin required to kill Chlamydia. Monolayers were stained with DAPI, a polyclonal HtrA antibody and secondary anti-rabbit antibody which stains chlamydial inclusion bodies [5254], and visualised on the InCell 2200. Statistical analysis was performed on the Prism GraphPad software [55]. A one-way ANOVA followed by a Holm-Sidak’s multiple comparisons test was performed relative to the control.

Results and discussion

Characterisation of koala cathelicidins expressed in different tissues

Ten cathelicidins were identified within a 1.3Mb region on scaffold 76 of the koala genome and were named in order of identification (S1 Table). Five cathelicidins, PhciCath1, 2, 3, 5 and 6, were full-length and contained complete open reading frames. One cathelicidin, PhciCath4, contained a premature stop codon in exon 3 and hence is likely to be a pseudogene. Only partial sequences could be identified for four cathelicidins, PhciCath7p through 10p.

All koala cathelicidins contained sequence features characteristic of the cathelicidin family (Fig 1) [24]. Koala cathelicidin genes contained four exons, which encode a prepropeptide consisting of three domains. The signal peptide and cathelin domain contained conserved stretches of sequence, including four cysteine residues in the latter which are a distinguishing feature of the family and provide structure to the prepropeptide (Fig 1) [24]. For PhciCath1, 2, 3, 5 and 6 with full-length sequences, the antimicrobial domain which encodes the mature peptide was variable in length and composition (Table 1), with a maximum 30% amino acid similarity amongst the five predicted mature peptide sequences (S1 Table). Tasmanian devil cathelicidins also display a similar level of variability in this domain, however in eutherian mammals such as pigs, amino acid similarity can be as high as 94% [30].

Multiple sequence alignment of koala cathelicidins with other marsupial and eutherian cathelicidins.
Fig 1

Multiple sequence alignment of koala cathelicidins with other marsupial and eutherian cathelicidins.

PhciCath4 was not included in the alignment as it contains a premature stop codon and hence is a likely a pseudogene. PhciCath7p to 10p are partial sequences only, as the mature peptide could not be identified. The predicted signal peptide sequence is underlined, followed by two domains; the cathelin domain which contains conserved cysteine residues (boxed), and the antimicrobial domain which encodes the mature peptide and is of variable length and composition. The predicted mature peptide cleavage site is denoted by a star.

Table 1
Physiochemical properties of predicted mature peptides from full-length koala cathelicidins.
CathelicidinSequenceMolecular weight (g/mol)Charge at pH7Hydrophobic %GRAVY score
PhciCath1LFPRRRKGSNKPGKYSVLFAAKPSVGKTPHILTI3765.498.144.12-0.424
PhciCath2NFIHQKYRILLDKYRKLQDIFSGSGDKV3382.903.232.14-0.682
PhciCath3PPEPLRFKRIRCLNGRKCNYHNLLLTIVPHWRIPKGK4465.388.343.24-0.695
PhciCath5KRGGIWKLIRPLGRGAGRILRHFHIDFCGNC3548.236.338.71-0.219
PhciCath6ASSGIIDTSSLPPKIRQIYNQAVYDTLVGILRNF3751.710.944.120.106

All five mature peptides are of a similar molecular weight, and most display a high cationic charge at pH 7. The percentage of hydrophobic amino acids and grand average of hydropathicity (GRAVY) score for each mature peptide is also presented. The GRAVY score measures the hydrophilicity or hydrophobicity of a peptide, with negative and positive scores indicating a hydrophilic and hydrophobic peptide respectively.

Koala cathelicidins cluster with other marsupial cathelicidins in the gene tree, as expected (Fig 2). PhciCath1, 3 and 6 are orthologs of MaeuCath8, SahaCath1 and ModoCath8 respectively, indicating that these genes arose prior to speciation and have been conserved throughout evolution. PhciCath2 and 5 cluster within a marsupial-specific clade, sister to that containing eutherian cathelicidins (Fig 2). Interestingly, PhciCath5 is located in the clade containing SahaCath3, 5 and 6, ModoCath4, and MaeuCath1 and 7 (Fig 2), all of which display antimicrobial activity [30,35,56]. Focusing on the conserved cathelin domain, the inclusion of partial koala sequences PhciCath7p to 10p does not influence the clustering of koala cathelicidins (S1 Fig). Although, PhciCath5 now clusters with PhciCath7p to 10p within the marsupial clade, forming a koala-specific expansion. The short branch lengths of PhciCath5 and PhciCath7p to 10p indicate that these genes likely arose through more recent duplications, compared to PhciCath1, 2, 3 and 6 (S1 Fig). Although, PhciCath7p through 10p may represent pseudogenes and hence not accurately portray phylogeny of functional koala cathelicidins.

Full-length koala cathelicidins cluster with other marsupials in the phylogenetic tree, particularly PhciCath5 which clusters with other marsupial cathelicidins that display antimicrobial activity.
Fig 2

Full-length koala cathelicidins cluster with other marsupials in the phylogenetic tree, particularly PhciCath5 which clusters with other marsupial cathelicidins that display antimicrobial activity.

Sequences are coloured according to antimicrobial activity against bacteria and/or fungi; blue indicates active, red indicates inactive and black indicates the peptide has not been tested. Koala cathelicidins are denoted by a green circle. Only bootstrap values greater than 70% are shown. Accession numbers for published sequences used in this tree are available in S3 Table.

Only full-length cathelicidins PhciCath1, 2, 3, 5 and 6 were included in subsequent analyses as without the full coding sequence, partial sequences of PhciCath7p through 10p could represent pseudogenes. Koala cathelicidins were transcribed in numerous tissues, similar to other marsupial [30,35] and eutherian cathelicidins [57]. Cathelicidin transcripts were detected in respiratory, cardiovascular, immune, reproductive and excretory tissues from two wild koalas (Fig 3) [42]. PhciCath1 had the greatest expression of any cathelicidin and the greatest breadth, with transcripts present in all fifteen tissue transcriptomes (Fig 3). This broad expression of cathelicidins within multiple organ systems is likely derived from epithelial cells, which in humans constitutively express cathelicidins [57]. Here they likely provide rapid defence against infection, without the lag imposed by the recruitment and activation of neutrophils.

Expression of full-length koala cathelicidins in twelve tissue transcriptomes from two individuals [41,42].
Fig 3

Expression of full-length koala cathelicidins in twelve tissue transcriptomes from two individuals [41,42].

Expressed as transcripts per million (TPM).

With the exception of PhciCath1, cathelicidin expression is favoured in immune tissues over non-immune tissues, although variation between the two individuals is marked (Fig 3). All five cathelicidins PhciCath1, 2, 3, 5 and 6 were expressed in the bone marrow, likely due to the presence of neutrophil precursors as observed in humans [58] and guinea pigs [59]. Expression of cathelicidins within neutrophils changes throughout cell development, and peaks during the myelocyte and metamyelocyte stage within the bone marrow [58,59]. Tammar wallaby MaeuCath1 was also expressed in the bone marrow, and peak expression coincided with maturation of immune organs in pouch young [25]. All koala cathelicidins except PhciCath2 were expressed in the lymph node, and a high number of PhciCath3 transcripts were present in the spleen (Fig 3). A high level of cathelicidin expression within koala immune tissues is not surprising given their localised expression within neutrophils and epithelial cells, and similar results observed in other marsupials [25,30].

PhciCath1 and 6 proteins were present in the koala milk proteome, along with PhciCath3 transcripts in the mammary gland [41], and hence may provide a direct source of immune compounds to developing young. Similar findings were reported by Morris et al. (2016) where cathelicidins were detected in a koala early lactation mammary gland transcriptome and late lactation milk proteome [41]. Cathelicidins were relatively abundant in late lactation, comprising 1.1% of peptides [41]. Tasmanian devil milk also contained cathelicidins [30], similarly tammar wallaby cathelicidins were expressed in the mammary gland throughout lactation [35]. The presence of cathelicidins within the milk of three marsupial species suggests this feature is conserved across different marsupial lineages, indicating these peptides may play an essential role in pouch young protection and development [25,30].

Koala cathelicidin PhciCath5 shows direct antimicrobial activity

Koala cathelicidin PhciCath5 was the only peptide to display antimicrobial activity when screened against representative Gram negative and positive bacterial strains, with the most potent activity detected against E. coli (MIC 16μg/mL) and S. aureus (8μg/mL) isolates (Table 2). PhciCath5 also displayed antifungal activity against the ATCC strains Candida parapsilosis 22019 and Candida krusei 6258. The spectrum of activity was similar to that of other marsupial [30,35,60] and monotreme [35,60] cathelicidins. PhciCath5 was also active against the test strain of methicillin-resistant Staphylococcus aureus (MRSA) with an MIC of 16μg/mL. This MIC value is more potent than Tasmanian devil SahaCath5 against the same MRSA isolate [30], and within the range of MICs reported for human, bovine and rabbit cathelicidins against different MRSA isolates [61]. MRSA is a pathogen of major concern to human health [62], and antimicrobials such as cathelicidins provide novel alternatives for development as they generally do not induce resistance as observed with traditional antibiotics [61,63].

Table 2
Koala cathelicidin mature peptide PhciCath5 displays antimicrobial activity against bacteria and fungi from humans and animals, expressed as the minimum inhibitory concentration (MIC).
StrainPhciCath5 MIC (μg/mL)
P. aeruginosa*>64
P. aeruginosa ATCC27853>64
E. coli*16
E. coli ATCC2592264 (11)
22a
>175b
S. aureus*8
S. aureus ATCC2921316 (11)
MRSA*16
S. pneumoniae ATCC49619>64
S. pyogenes ATCC1961564
S. agalactiae ATCC1238664
S. agalactiae*64
S. dysgalactiae>64
S. lutetiensis>64
S. equi*>64
S. oralis>64
S. salivarius64
S. mutans>64
L. monocytogenes*64
P. multocida*>64
K. pneumoniae*>64
C. parapsilosis ATCC 2201932
C. krusei ATCC 625864
C. glabrata>64
C. albicans>64

The MIC of PhciCath1, 2, 3 and 6 was >64ug/mL for all bacteria and fungi tested.

*denotes animal isolate, otherwise human clinical isolates and ATCC strains were tested. MICs were obtained using MH II B that contains magnesium and calcium divalent cations. MICs in brackets were obtained using MHB without the additional of aforementioned divalent cations.

a denotes MICs obtained using MHB with 10% foetal bovine serum.

b denotes MICs obtained using MHB with 20% whole mouse blood.

Despite this promising activity profile in vitro, multiple inhibitors present within the in vivo environment are known to influence antimicrobial activity. Indeed, antibacterial activity of PhicCath5 against the E. coli ATCC strain was neutralised in 20% whole blood, resulting in an increase in the MIC from 64 μg/mL to >175μg/mL, and a reduction in the MIC in 10% FCS from 22μg/mL to 11μg/mL (Table 2). This indicates that PhciCath5 may bind non-specifically to proteins within the blood, sequestering the peptides, or is enzymatically degraded, both of which have been documented with human [64], rabbit and sheep cathelicidins [65].

As observed in eutherian cathelicidins [66,67], adherence of PhciCath5 to pathogens was facilitated by electrostatic interactions between positively charged cathelicidins and negatively charged head groups on the surface of bacterial cell membranes. Divalent cations bind to the negatively charged head groups, thereby preventing interaction with positively charged cathelicidins [68]. This is evidenced by a reduction in antimicrobial activity following the addition of magnesium and calcium divalent cations to the media. The MIC of PhciCath5 against E. coli increased five-fold in the presence of divalent cations, while the effect on the MIC against S. aureus was less pronounced (Table 2). Given that electrostatic interaction enables pathogen adherence, a high cationic charge often correlates with antimicrobial activity amongst many eutherian cathelicidins [69], however we found no such association amongst koala cathelicidins.

Following electrostatic attachment, PhciCath5 rapidly permeabilised bacterial cell membranes at high concentrations. At 44μg/mL, four times the MIC of 11μg/mL, PhciCath5 permeabilised ≥5% of the E. coli ATCC25922 cell membrane, leading to cell death within an hour of treatment (S2 Fig). However at the MIC, PhciCath5 was slow-acting, as the same level of membrane permeabilisation was only observed after three hours. This activity profile differs to tammar wallaby MaeuCath1 which rapidly killed bacteria at the MIC within 15 minutes [35]. The ability of eutherian cathelicidins to permeabilise bacterial cell membranes has been linked to an amphipathic alpha helical peptide structure [29,64,69]. The potent MaeuCath1 also forms an amphipathic alpha helix according to the predictive algorithms of Kyte and Doolittle, and Deleage and Roux [33,35]. Both algorithms suggest the same structure for PhciCath5 as observed in Fig 4A, with two alpha helical regions indicated by the scores rising above the 0.99 cutoff. While the negative GRAVY score suggests PhciCath5 is hydrophilic (Table 1), the Kyte and Doolittle hydropathicity plot reveals that PhciCath5 is amphipathic (Fig 4B). Hydrophilic residues span the middle of PhciCath5, with hydrophobic regions at the N and C-terminus. While PhciCath5 and MaeuCath1 both contain amphipathic alpha helical regions, additional physiochemical properties such as cationicity and sequence composition influence antimicrobial activity, and may explain the difference in activity and rate of permeabilisation between the two cathelicidins [69,70].

PhciCath5 contains two alpha helical regions according to the Deleage and Roux plot (A), as shown by the rise in scores above the 0.99 cutoff. PhciCath5 is also amphipathic according to the Kyte & Doolittle plot (B), with hydrophilic residues spanning the middle of the peptide (negative scores), and hydrophobic residues at the N- and C-terminus (positive scores). The remaining koala cathelicidin mature peptides all contain alpha helical regions (A), and vary in hydropathicity from largely hydrophilic (PhciCath2) to amphipathic (PhciCath1, 3, 5 and 6).
Fig 4

PhciCath5 contains two alpha helical regions according to the Deleage and Roux plot (A), as shown by the rise in scores above the 0.99 cutoff. PhciCath5 is also amphipathic according to the Kyte & Doolittle plot (B), with hydrophilic residues spanning the middle of the peptide (negative scores), and hydrophobic residues at the N- and C-terminus (positive scores). The remaining koala cathelicidin mature peptides all contain alpha helical regions (A), and vary in hydropathicity from largely hydrophilic (PhciCath2) to amphipathic (PhciCath1, 3, 5 and 6).

Permeabilisation of bacterial membranes by amphipathic alpha helical cathelicidins can be described by two models; the barrel stave model and the carpet model [66]. In the barrel stave model, aggregates of cathelicidins insert into the membrane and form transmembrane pores, thereby enabling leakage of essential molecules and disrupting transmembrane potential. Amphipathicity facilitates membrane insertion, as the hydrophobic surface of the peptide interacts with the lipid core of the bacterial cell membrane, and the hydrophilic surface forms the lining of the pore [66]. Alternatively, the carpet model does not involve peptide insertion. Instead cathelicidins bind to the surface of the membrane until a threshold concentration is reached, which disrupts the curvature of the membrane leading to destabilisation [66]. These results are speculative, and lipid membrane models would be required to confirm the mechanism of PhciCath5 membrane permeabilisation.

Koala cathelicidins PhciCath1, 2, 3 and 6 were inactive against all bacteria and fungi included in our assays at the concentrations tested. However, given the diversity and complexity of marsupial microbiomes known to contain novel and uncharacterised taxa [7173], it is possible that they have activity against specific bacteria and fungi not tested in this study. Some marsupial cathelicidins have shown selective activity, such as Tasmanian devil SahaCath3 which was only active against Cryptococcus neoformans [30]. However, PhciCath1, 3 and 6 are orthologous to marsupial cathelicidins in which antimicrobial activity has not been demonstrated (Fig 2) [26,60]. Conservation of PhciCath1, 2, 3 and 6 suggests an essential function that has been conserved throughout marsupial evolution. The high level of expression in immune tissues (Fig 3) supports a role in modulating the immune response. While the immunomodulatory functions of marsupial cathelicidins remain to be tested, eutherian cathelicidins are chemotactic to various immune cells, modulate immune cell development and alter cytokine expression profiles [24].

PhciCath5 is active against Chlamydia pecorum

Koala cathelicidin PhciCath5 inactivated C. pecorum MarsBar and IPTaLE elementary bodies (EB) and was the only peptide tested that caused biologically and statistically significant reductions in chlamydial inclusions. Treatment with 125μg/mL of PhciCath5 resulted in a more than 2 orders of magnitude decrease in infectious progeny of both C. pecorum serovars, compared with the control (Fig 5). PhciCath1, 2, 3 and 6 were inactive at concentrations up to 500μg/mL, with less than half an order of magnitude difference in chlamydial inclusions compared with the control. Other marsupial cathelicidins have not been tested for anti-chlamydial activity and only a handful of studies have tested eutherian cathelicidins. They revealed wide variation in activity between chlamydial species and serovars [36,37,74,75]. Cathelicidins from humans and livestock inactivated a number of C. trachomatis isolates [3639,74,75], especially pig protegrin PG-1 which reduced the infectivity of C. trachomatis at 1.25μg/mL [75]. Comparison of these results with koala cathelicidins presented in this study indicate the anti-chlamydial activity of PhciCath5 against C. pecorum is moderate at most, given PhciCath5 was active at over 100-fold higher concentration than PG-1, albeit against different Chlamydia species. However, experimental conditions used by Yasin et al 1996 differed from our study, as only a single round of infection was performed, and the reduction in inclusions or change in inclusion morphology measured. This is effectively a MIC, or the minimum cathelicidin concentration required to inhibit formation of chlamydial inclusions, but may not have killed the EB. In this study we conducted two rounds of infection, then measured the reduction in chlamydial infectivity. As such, our results effectively represent the minimum chlamydicidal concentration (MCC), or the minimum concentration of PhciCath5 which killed Chlamydia and hence reduced chlamydial infectivity [74]. Furthermore, the same eutherian cathelicidins which have activity against C. trachomatis were ineffective against one C. pecorum isolate at a maximum concentration of 80μg/mL [37]. However, eutherian cathelicidins have not been extensively tested against this Chlamydia species. Despite this, it is possible that koala cathelicidins evolved anti-chlamydial activity in response to host-pathogen co-evolution, and form part of the rapid innate defence at the mucosal surface.

Activity of koala cathelicidins PhciCath1, 2, 3, 5 and 6 against C. pecorum MarsBar (A) and IPTaLE (B) at 125μg/mL. Expressed as inclusion forming units (IFU) per mL. Treatment of C. pecorum MarsBar and IPTaLE elementary bodies with 125μg/mL of PhciCath5 caused a significant decrease in infectious progeny in both serovars. PhciCath1, 2, 3 and 6 were ineffective against both serovars up to a concentration of 500ug/mL. **** indicates p<0.0001 significance was identified.
Fig 5

Activity of koala cathelicidins PhciCath1, 2, 3, 5 and 6 against C. pecorum MarsBar (A) and IPTaLE (B) at 125μg/mL. Expressed as inclusion forming units (IFU) per mL. Treatment of C. pecorum MarsBar and IPTaLE elementary bodies with 125μg/mL of PhciCath5 caused a significant decrease in infectious progeny in both serovars. PhciCath1, 2, 3 and 6 were ineffective against both serovars up to a concentration of 500ug/mL. **** indicates p<0.0001 significance was identified.

Koala PhciCath5 acted directly upon, and inactivated C. pecorum MarsBar and IPTaLE EB. Removal of cathelicidins through centrifugation prior to chlamydial infection of the cell monolayer suggests PhciCath5 most likely induces permanent damage to the EBs within 2 hours, rather than preventing EB uptake into the host cell. Similar results were observed for pig protegrin-1 (PG-1) against three C. trachomatis serovars after a single round of infection [75]. This study revealed that PG-1 interacted directly with EBs and caused significant morphological changes, including membrane damage, loss of cytoplasm and nucleus [75]. Given that Chlamydia are Gram-negative bacteria, PhciCath5 may affect membrane permeability as it did in E. coli. However, Chlamydia EB have a strong, cross-linked outer membrane which differs substantially from the outer membrane of E. coli [75]. Because of its small size, only 31 residues in length, PhciCath5 may be able to penetrate through these structures and bind to the outer membrane of C. pecorum.

If PhciCath5 inactivates EBs, why are koalas with chlamydiosis unable to clear C. pecorum infection naturally? PhciCath5 and other koala cathelicidins may be present at the site of Chlamydia infection, secreted from epithelial cells or infiltrating immune cells. This is evidenced by expression in immune tissues such as the bone marrow, lymph node and spleen (Fig 2). Cathelicidins are expressed within neutrophils, lymphocytes and macrophages [76], all of which infiltrate the submucosa of the conjunctiva, urogenital and reproductive tract of the koala during infection [77]. However, it is unlikely that PhciCath5 reaches the effective concentration of 125μg/mL in vivo which inactivated EBs in vitro. The human cathelicidin LL-37 is present in plasma at a concentration of 1.2μg/mL [78] and bronchioalveolar lavage fluid up to 15μg/mL [79]. As such, cathelicidin expression at the site of Chlamydia infection may not be adequate to influence the progression of infection. Further work is required to quantify cathelicidin concentration at the site of infection in order to determine susceptibility in vitro at a representative concentration.

Our results show PhciCath5 has activity against extracellular EB. Timing of cathelicidin release from immune and epithelial cells within the host may not enable direct interaction with EB. Intracellular Chlamydia may be more resistant to cathelicidin attack, as treatment of intracellular C. trachomatis with PG-1 resulted in a 67% reduction in infectivity, compared to almost 100% reduction following treatment of extracellular EBs [74]. Indeed, proteases secreted by this C. trachomatis neutralise LL-37 anti-chlamydial activity, thereby evading AMP attack and ensuring extracellular EB survival. Chlamydia protease-like factor (CPAF) [38] and Chlamydia high temperature requirement protein A (cHtrA) [39] both specifically degrade LL-37. Whereas the plasmid encoded virulence factor pgp3 binds to, and forms stable complexes with LL-37, neutralising anti-chlamydial activity [80]. Interestingly, pgp3 also blocks LL-37 pro-inflammatory functions, which delays the inflammatory response and promotes Chlamydia survival [81]. Pgp3 also uses LL-37 to enhance its own pro-inflammatory activity on neutrophils, which may aid Chlamydia spreading [81]. CPAF, cHtrA and pgp3 are secreted into the cytoplasm of infected host cells and released upon host cell lysis, degrading or neutralising extracellular LL-37 before exposure of intra-inclusion EB [38,39,81]. C. pecorum also contains the genes which encode the aforementioned virulence factors [11,52,82,83], and both MarsBar and IpTaLE serovars possess the plasmid which encodes pgp3 [82,83]. While AMP evasion strategies have not been investigated in C. pecorum, given the presence of virulence factors and results in C. trachomatis, there is potential for the anti-chlamydial activity of PhciCath5 to be inactivated in vivo.

Drug development potential

The broad-spectrum activity of PhciCath5 against bacteria and fungi, including drug-resistant MRSA, as well as C. pecorum suggests that it shows promise for development as a therapeutic. Peptide modification is required to identify residues responsible for antimicrobial activity, and those involved in non-specific binding to blood proteins, similar to the alanine scans performed for LL-37 and derivatives [84,85]. Additional assays are required to assess mammalian cell toxicity, one of the main barriers to cationic peptide development. A number of marsupial cathelicidins are cytotoxic, although mainly at concentrations far above the MIC [26,60]. Many eutherian cathelicidins are currently under pharmaceutical development as topical agents because they were associated with toxicity, low tissue penetration and peptide degradation when trialled for systemic use [86]. Derivatives of LL-37 and bovine indolicidin are currently in development as topical agents, while a topical formulation of PG-1 derivative known as Iseganan has reached phase III clinical trials for the treatment of oral mucositis [86]. Topical antibiotics are commonly used for the treatment of ocular chlamydiosis in koalas due to ease of application [87], hence topical cathelicidin formulations may provide alternative treatment options in the future.

Synergy between cathelicidins and traditional antibiotics has resulted in increased antimicrobial activity [24]. Perhaps the same is true for PhciCath5 and chloramphenicol, which is commonly used to treat chlamydiosis in koalas [21]. Given its broad-spectrum activity, topical application of PhciCath5 may also prevent or reduce secondary infections involving Gram-negative and Gram-positive bacteria or fungi, which have been reported in koala chlamydiosis [87].

Conclusions

We characterised ten cathelicidins in the koala, five of which were full-length sequences that were widely expressed in tissues throughout the body. One cathelicidin, PhciCath5 displayed broad-spectrum antimicrobial activity against representative bacteria and fungi, including drug resistant strains. The activity of the remaining four cathelicidins may be highly specific or immunomodulatory. When tested against Chlamydia, PhciCath5 significantly reduced the infectivity of C. pecorum IPTaLE and MarsBar by inactivating elementary bodies prior to infection. Despite this, PhciCath5 may be unable to prevent or control C. pecorum infections in koalas due to inadequate peptide concentration at the site of infection, timing of peptide release or production of AMP-degrading proteases by Chlamydia. PhciCath5 represents a lead for antimicrobial development, with additional work required to confirm the absence of toxicity, explore potential synergistic effects with current antibiotics, and introduce peptide modifications that enhance antimicrobial activity.

References

HTyndale-Biscoe. Life of Marsupials. Victoria, Australia: CSIRO Publishing; 2005.

CDickman, DDricoll, SGarnett, DKeith, SLegge, DLindenmayer, et al. After the catastrophe: a blueprint for a conservation response to large-scale ecological disaster. Threatened Species Recovery Hub, 2020.

The Australian Government DoA, Water and the Environment. Rapid analysis of impacts of the 2019–20 fires on animal species, and prioritisation of species for management response. The Australian Government; 2020.

LVan Eeden, DNimmo, MMahony, KHerman, GEhmke, JDriessen, et al. Australia’s 2019–20 bushfires: the wildlife toll. World Wide Fund for Nature Australia, 2020.

APolkinghorne, JHanger, PTimms. Recent advances in understanding the biology, epidemiology and control of chlamydial infections in koalas. Veterinary Microbiology. 2013;165:21423. 10.1016/j.vetmic.2013.02.026

BLQuigley, PTimms. Helping koalas battle disease–Recent advances in Chlamydia and koala retrovirus (KoRV) disease understanding and treatment in koalas. FEMS Microbiology Reviews. 2020. 10.1093/femsre/fuaa024

NSW Government Department of Planning IaE. NSW fire and the environment 2019–20 summary. In: NSW Govenment Department of Planning IaE, editor. Sydney: Department of Planning, Industry and Environment; 2020. p. 20.

LFGrogan, AJPeel, DHKerlin, EEllis, DJones, JHero, et al. Is disease a major causal factor in declines? An evidence framework and case study on koala chlamydiosis. Biological Conservation. 2018;221:33444.

MEKinney, GWPye. Koala retrovirus: a review. Journal of Zoo and Wildlife Medicine. 2016;47(2):38796. 10.1638/2015-0185.1

10 

NKido, KMakimura, CKamegaya, IShindo, EShibata, TOmiya, et al. Long-term surveillance and treatment of subclinical cryptococcosis and nasal colonization by Cryptococcus neoformans and C.gattii species complex in captive koalas (Phascolarctos cinereus) Medical Mycology. 2012;50:2918. 10.3109/13693786.2011.594967

11 

NLBachmann, TAFraser, CBertelli, MJulocnik, AGillett, OFunnell, et al. Comparative genomics of koala, cattle and sheep strains of Chlamydia pecorum. BMC Genomics. 2014;15(1):66781. 10.1186/1471-2164-15-667

12 

MJackson, NWhite, PGiffard, PTimms. Epizootiology of Chlamydia infections in two free-range koala populations. Veterinary Microbiology. 1999;65:25564. 10.1016/s0378-1135(98)00302-2

13 

SPhillips, BLQuigley, PTimms. Seventy years of Chlamydia vaccine research—limitations of the past and directions for the future. Frontiers in Microbiology. 2019;10(70). 10.3389/fmicb.2019.00070

14 

MDesclozeaux, ARobbins, MJelocnik, SAKhan, JHanger, VGerdts, et al. Immunization of a wild koala population with a recombinant Chlamydia pecorum Major Outer Membrane Protein (MOMP) or Polymorphic Membrane Protein (PMP) based vaccine: New insights into immune response, protection and clearance. PLOS ONE. 2017;12(6):e0178786. 10.1371/journal.pone.0178786

15 

ROsawa, FNCarrick. Use of a dietary supplement in koalas during systemic antibiotic treatment of chlamydial infection. Australian Veterinary Journal. 1990;67(8):3057. 10.1111/j.1751-0813.1990.tb07805.x

16 

AGillett, JHanger. Koala. In: LVogelnest, TPortas, editors. Current Therapy in Medicine of Australian Mammals. Clayton, Victoria, Australia: CSIRO Publishing; 2019. p. 46386.

17 

JEGriffith, DPHiggins, KMLi, MBKrockenberger, MGovendir. Absorption of enrofloxacin and marbofloxacin after oral and subcutaneous administration in diseased koalas (Phascolarctos cinereus). Journal of Veterinary Pharmacology and Therapeutics. 2010;33(6):595604. 10.1111/j.1365-2885.2010.01169.x

18 

LABlack, AJMcLachlan, JEGriffith, DPHiggins, AGillett, MBKrockenberger, et al. Pharmacokinetics of chloramphenicol following administration of intravenous and subcutaneous chloramphenicol sodium succinate, and subcutaneous chloramphenicol, to koalas (Phascolarctos cinereus). Journal of Veterinary Pharmacology and Therapeutics. 2012;36(5):47885. 10.1111/jvp.12024

19 

ARobbins, JLoader, PTimms, JHanger. Optimising the short and long-term clinical outcomes for koalas (Phascolarctos cinereus) during treatment for chlamydial infection and disease. PLoS one. 2018;13(12):e0209679. 10.1371/journal.pone.0209679

20 

LABlack, CBLandersdorfer, JBBulitta, JEGriffith, MGovendir. Evaluation of enrofloxacin use in koalas (Phascolarctos cinereus) via population pharmacokinetics and Monte Carlo simulation. Journal of Veterinary Pharmacology and Therapeutics. 2014;37(3):30111. 10.1111/jvp.12091

21 

MGovendir, JHanger, JJLoader, BKimble, JEGriffith, LABlack, et al. Plasma concentrations of chloramphenicol after subcutaneous administration to koalas (Phascolarctos cinereus) with chlamydiosis. Journal of Veterinary Pharmacology and Therapeutics. 2012;35:14754. 10.1111/j.1365-2885.2011.01307.x

22 

CBudd, CFlanagan, AGillett, JHanger, JJLoader, MGovendir. Assessment of florfenicol as a possible treatment for chlamydiosis in koalas (Phascolarctos cinereus). Australian Veterinary Journal. 2017;95(9):3439. 10.1111/avj.12617

23 

SPhillips, BLQuigley, AAziz, WBergen, RBooth, MPyne, et al. Antibiotic treatment of Chlamydia-induced cystitis in the koala is linked to expression of key inflammatory genes in reactive oxygen pathways. PLoS one. 2019;14(8):e0221109. 10.1371/journal.pone.0221109

24 

EMKosciuczuk, PLisowski, JJarczak, NStrzalkowska, AJozwik, JHorbanczuk, et al. Cathelicidins: family of antimicrobial peptides. A review. Molecular Biology Reports. 2012;39:1095770. 10.1007/s11033-012-1997-x

25 

KADaly, MRDigby, CLefevre, KRNicholas, EMDeane, PWilliamson. Identification, characterization and expression of cathelicidin in the pouch young of tammar wallaby (Macropus eugenii). Comparative Biochemistry and Physiology. 2008;149:52433.

26 

EPeel, YCheng, JTDjordjevic, SFox, TCSorrell, KBelov. Cathelicidins in the Tasmanian devil (Sarcophilus harrisii). Scientific Reports. 2016;6:e35019.

27 

KBelov, CESanderson, JEDeakin, ESWWong, DAssange, KAMcColl, et al. Characterization of the opossum immune genome provides insight into the evolution of the mammalian immune system. Genome Research. 2007;17:98291. 10.1101/gr.6121807

28 

H-sCho, JYum, ALarivière, NLévêque, QVCLe, BAhn, et al. Opossum Cathelicidins Exhibit Antimicrobial Activity Against a Broad Spectrum of Pathogens Including West Nile Virus. Frontiers in Immunology. 2020;11(347). 10.3389/fimmu.2020.00347

29 

BAgerberth, HGunne, JOdeberg, PKooner, HGBoman, GHGudmundsson. FALL-39, a putative human peptide antibiotic, is cysteine-free and expressed in bone marrow and testis. Proceedings of the Natural Academy of Sciences USA. 1995;92:1959. 10.1073/pnas.92.1.195

30 

EPeel, YCheng, JTDjordjevic, SFox, TCSorrell, KBelov. Cathelicidins in the Tasmanian devil (Sarcophilus harrisii). Scientific Reports. 2016;6:35019. 10.1038/srep35019

31 

KBasden, DWCooper, EMDeane. Development of the lymphoid tissues of the tammar wallaby Macropus eugenii. Reproduction, Fertility and Development. 1997;9:24354. 10.1071/r96032

32 

ROsawa, WHBlanshard, PGO’Callaghan. Microflora of the Pouch of the Koala (Phascolarctos cinereus). Journal of Wildlife Disease. 1992;28(2):27680. 10.7589/0090-3558-28.2.276

33 

SSWanyonyi, JASharp, CLefevre, EKhalil, KRNicholas. Tammar wallaby mammary cathelicidins are differentially expressed during lactation and exhibit antimicrobial and cell proliferative activiy. Comparative Biochemistry and Physiology. 2011;160:4319. 10.1016/j.cbpa.2011.07.015

34 

GBobek, EMDeane. Possible antimicrobial compounds from the pouch of the koala, Phascolarctos cinereus. Letters in Peptide Science. 2002;8:1337.

35 

JMWang, ESWWong, JCWhitely, JLi, JMStringer, KRShort, et al. Ancient antimicrobial peptides kill antibiotic-resistant pathogens: Australian mammals provide new options. PLOS ONE. 2011;6(8):18. 10.1371/journal.pone.0024030

36 

MDonati, ADFrancesco, RGennaro, MBenincasa, SMagnino, SPignanelli, et al. Sensitivity of Chlamydia suis to cathelicidin peptides. Veterinary Microbiology. 2007;123:26973. 10.1016/j.vetmic.2007.02.011

37 

MDonati, KDLeo, MBenincasa, FCavrini, SAccardo, AMoroni, et al. Activity of cathelicidin peptides against Chlamydia spp. Antimicrobial Agents and Chemotherapy. 2005;49(3):12012. 10.1128/AAC.49.3.1201-1202.2005

38 

LTang, JChen, ZZhou, PYu, ZYang, GZhong. Chlamydia-secreted protease CPAF degrades host antimicrobial peptides. Microbes and Infection. 2015;17:4028. 10.1016/j.micinf.2015.02.005

39 

WDong, WZhang, JHou, MMa, CZhu, HWang, et al. Chlamydia-secreted protease Chlamydia high temperature requirement protein A (cHtrA) degrades human cathelicidin LL-37 and suppresses its anti-chlamydial activity. Medical Science Monitor. 2020;26:e923909. 10.12659/MSM.923909

40 

RNJohnson, DO’Meally, ZChen, GJEtherington, SYWHo, WJNash, et al. Adaptation and conservation insights from the koala genome. Nature Genetics. 2018;50(8):110211. 10.1038/s41588-018-0153-5

41 

KMMorris, DO’Meally, TZaw, XSong, AGillett, MPMolloy, et al. Characterisation of the immune compounds in koala milk using a combined transcriptomic and proteomic approach. Scientific Reports. 2016;6:35011. 10.1038/srep35011

42 

MHobbs, APavasovic, AGKing, PJPrentis, MDBEldridge, ZChen, et al. A transcriptome resource for the koala (Phascolarctos cinereus): insights into koala retrovirus transcription and sequence diversity. BMC Genomics. 2014;15(786). 10.1186/1471-2164-15-786

43 

JDThompson, DGHiggins, TJGibson. Clustal W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position specific gap penalties and weight matrix choice. Nucleic Acids Research. 1994;22:467380. 10.1093/nar/22.22.4673

44 

THall. BioEdit v7.2.2 ed: Ibis Biosciences; 2013.

45 

TNPeterson, SBrunak, Gvon Heijne, HNielsen. SignalP4.0: discriminating signal peptides from transmembrane regions. Nature Methods. 2011;8:7856. 10.1038/nmeth.1701

46 

SKumar, GStecher, KTamura. MEGA7: molecular evolutionary genetics analysis version 7.0 for bigger datasets Molecular Biology and Evolution. 2016;33(7):1870 4. 10.1093/molbev/msw054

47 

ADobin, TRGingeras. Mapping RNA-seq reads with STAR. Current Protocols in Bioinformatics. 2015;51:11.4.1. 10.1002/0471250953.bi1114s51

48 

MPertea, GMPertea, CMAntonescu, TChang, JTMendell, SLSalzberg. StringTie enables improved reconstruction of a transcriptome from RNA-seq reads. Nature Biotechnology. 2015;33(3):2908. 10.1038/nbt.3122

49 

JKyte, RFDoolittle. A simple method for displaying the hydropathic character of a protein. Journal of Molecular Biology. 1982;157:10532. 10.1016/0022-2836(82)90515-0

50 

GDeleage, BRoux. An algorithm for protein secondary structure prediction based on class prediction. Protein Engineering. 1987;1:28994. 10.1093/protein/1.4.289

51 

EGasteiger, CHoogland, AGattiker, SDuvaud, MRWilkins, RDAppel, et al. Protein identification and analysis tools on the ExPASy server. In: JMWalker, editor. The proteomics protocols handbook. New York: Humana Press; 2005. p. 571607.

52 

ALawrence, TFraser, AGillett, JDATyndall, PTimms, APolkinghorne, et al. Chlamydia serine protease inhibitor, targeting HtrA, as a new treatment for koala Chlamydia infection. Scientific Reports. 2016;6:3146678. 10.1038/srep31466

53 

WMHuston, JESwedberg, JMHarris, TPWalsh, SAMatthews, PTimms. The temperature activated HtrA protease from pathogen Chlamydia trachomatis acts as both a chaperone and protease at 37°C. FEBS letters. 2007;581:33826. 10.1016/j.febslet.2007.06.039

54 

WMHuston, CTheodoropoulos, SAMatthews, PTimms. Chlamydia trachomatis responds to heat shock, penicillin induced persistence, and IFN-gamma persistence by altering levels of extracytoplasmic stress response protease HtrA. BMC Microbiology. 2008;8(190).

55 

GraphPad Software. Prism version 7.0 for windows. La Jolla California USA.

56 

EPeel, YCheng, JTDjordjevic, MKuhn, TCSorrell, KBelov. Marsupial and monotreme cathelicidins display antimicrobial activity, including against methicillin-resistant Staphylococcus aureus. Microbiology. 2017;163:145765. 10.1099/mic.0.000536

57 

MFrohm-Nilsson, BSandstedt, OSorensen, GWebier, NBorregaard, MStahle-Backdahl. The human cationic antimicrobial protein (hCAP18), a peptide antibiotic, is widely expressed in human squamous epithelial and colocalizes with interleukin-6. Infection and Immunity. 1999;67(5):25616. 10.1128/IAI.67.5.2561-2566.1999

58 

JMalm, OSorensen, TPersson, MFrohm-Nilsson, BJohansson, ABjartell, et al. The human cationic antimicrobial protien (hCAP-18) is expressed in the epithelium of human epididymus, is present in seminal plasma at high concentrations, and is attached to spermatozoa. Infection and Immunity. 2000;68(7):4297302. 10.1128/iai.68.7.4297-4302.2000

59 

INagaoka, YTsutsumi-Ishii, SYomogida, TYamashita. Isolation of cDNA encoding Guinea Pig neutrophil cationic antibacterial polypeptide of 11kDa (CAP11) and evaluation of CAP11 mRNA expression during neutrophil maturation. The Journal of Biological Chemistry. 1997;272(36):2274250. 10.1074/jbc.272.36.22742

60 

EPeel, YCheng, JTDjordjevic, MKuhn, TSorrell, KBelov. Marsupial and monotreme cathelicidins display antimicrobial activity, including against methicillin-resistant Staphylococcus aureus. Microbiology. 2017;163:145765. 10.1099/mic.0.000536

61 

SBlodkamp, KKadlec, TGutsmann, HYNaim, Mvon Köckritz-Blickwede, SSchwarz. In vitro activity of human and animal cathelicidins against livestock-associated methicillin-resistant Staphylococcus aureus. Veterinary Microbiology. 2016;194:10711. 10.1016/j.vetmic.2015.09.018

62 

World Health Organisation. Antimicrobial resistance. Global report on surveillance. 2014.

63 

EJAVeldhuizen, ECBrouwer, VAFSchneider, ACFluit. Chicken cathelicidins display antimicrobial activity against multiresistant bacteria without inducing strong resistance. PLOS one. 2013;8(4):16. 10.1371/journal.pone.0061964

64 

JJohansson, GHGudmundsson, MERottenberg, KDBerndt, BAgerberth. Conformation-dependent antibacterial activity of the naturally occuring human peptide LL-37. The Journal of Biological Chemistry. 1998;273(6):371824. 10.1074/jbc.273.6.3718

65 

KHBartlett, PBMcCray, PSThorne. Reduction in the bactericidal activity of selected cathelicidin peptides by bovine calf serum or exogenous endotoxin. International Journal of Antimicorbial Agents. 2004;23:60612. 10.1016/j.ijantimicag.2004.02.018

66 

YShai. Mechanism of the binding, insertion and destabilization of phospholipid bilayer membranes by alpha-helical antimicrobial and cell non-selective membrane-lytic peptides. Biochemica et Biophysica Acta. 1999;1462:5570. 10.1016/s0005-2736(99)00200-x

67 

RCAnderson, PYu. Factors affecting the antimicrobial activity of ovine-derived cathelicidins against E.coli 0157:H7. International Journal of Antimicorbial Agents. 2005;25:20510. 10.1016/j.ijantimicag.2004.10.010

68 

DADevine, REWHancock. Cationic peptides: distribution and mechanisms of resistance. Current Pharmaceutical design. 2002;8:70314. 10.2174/1381612023395501

69 

STravis, NNAnderson, WRForsyth, CEspirtu, BDCondway, EPGreenberg, et al. Bactericidal activity of mammalian cathelicidin-derived peptides. Infection and Immunity. 2000;68(5):274855. 10.1128/iai.68.5.2748-2755.2000

70 

YRChan, MZanetti, RGennaro, RLGallo. Anti-microbial activity and cell binding are controled by sequence determinants in the anti-microbial peptide PR-39. The Society for Investigative Dermatology. 2001;116(2):2305.

71 

KChhour, LAHinds, NAJacques, EMDeane. An observational study of the microbiome of the maternal pouch and saliva of the tammar wallaby, Macropus eugenii, and of the gastrointestinal tract of the pouch young. Microbiology. 2010;156:798808. 10.1099/mic.0.031997-0

72 

NAlfano, ACourtiol, HVielgrader, PTimms, ALRoca, ADGreenwood. Variation in koala microbiomes within and between individuals: effect of body region and captivity status. Scientific Reports. 2015;5:10189. 10.1038/srep10189

73 

YCheng, SFox, DPemberton, CHogg, APapenfuss, KBelov. The Tasmanian devil microbiome—implications for conservation and management. Microbiome. 2015;3(1):76. 10.1186/s40168-015-0143-0

74 

BYasin, SSLHarwig, RILehrer, EAWagar. Susceptibility of Chlamydia trachomais to protegrins and defensins. Infection and Immunity. 1996;64(3):70913. 10.1128/IAI.64.3.709-713.1996

75 

BYasin, RILehrer, SSLHarwig, EAWagar. Protegrins: structural requirements for inactivating elementary bodies of Chlamydia trachomatis. Infection and Immunity. 1996;64(11):48676. 10.1128/IAI.64.11.4867-4871.1996

76 

BAgerberth, JCharo, JWerr, BOlsson, FIdali, LLindbom, et al. The human antimicrobial and chemotactic peptides LL-37 and alpha-defensin are expressed by specific lymphocyte and monocyte populations. Blood. 2000;96(9).

77 

SHemsley, PJCanfield. Histopathoogical and immunohistochemical investigation of naturally occuring chlamydial conjunctivitis and urgenital inflammation in koalas (Phascolarctos cinereus). Journal of Comparative Pathology. 1997;116(273–290).

78 

OSorensen, JBCowland, JAskaa, NBorregaard. An ELISA for hCAP-18, the cathelicidin present in human neutrophils and plasma. Journal of Immunological Methods. 1997;206:539. 10.1016/s0022-1759(97)00084-7

79 

CIChen, SSchaller-Bals, KPPaul, UWahn, RBals. Beta-defensins and LL-37 in bronchoalveolar lavage fluid of patients with cystic fibrosis. Journal of Cystic Fibrosis. 2004;3:4550. 10.1016/j.jcf.2003.12.008

80 

SHou, XDong, ZYang, ZLi, QLiu, GZhong. Chlamydial plasmid-encoded virulence factor Pgp3 neutralizes the antichlamydial activity of human cathelicidin LL-37. Infection and Immunity. 2015;83(12). 10.1128/IAI.00746-15

81 

SHou, XZSun, DX. Chlamydial plasmid-encoded virulence factor Pgp3 interacts with human cathelicidin peptide LL-37 to modulate immune response. Microbes and Infection. 2019;21:505. 10.1016/j.micinf.2018.06.003

82 

MJelocnik, LBachmann, BKaltenboeck, CWaugh, LWoolford, KNSpeight, et al. Genetic diversity in the plasticity zone and the presence of the chlamydial plasmid differentiates Chlamydia pecorum strains from pigs, sheep, cattle and koalas. BMC Genomics. 2015;16(893). 10.1186/s12864-015-2053-8

83 

MJelocnik, LBachmann, HSeth-Smith, NRThomson, PTimms, APolkinghorne. Molecular characterisation of the Chlamydia pecorum plasmid from porcine, ovine, bovine, and koala strains indicated plasmid-strain co-evolution. PeerJ. 2016;4(e1661). 10.7717/peerj.1661

84 

ATzitzilis, ABoura-Theodorou, VMichail, SPapadopoulos, KD, MELekka, et al. Catinoic amphipathic peptide analogs of cathelicidin LL-37 as a probe in the development of antimicrobial/anticancer agents. Journal of Peptide Science. 2019;26:e3254.

85 

SGunasekera, TMuhammad, AAStromstedt, KJRosengren, UGoransson. Alanine and lysine scans of the LL-37-derived peptide fragment KR-12 reveal key residues for antimicrobial activity. ChemBioChem. 2018;19:9319. 10.1002/cbic.201700599

86 

PKosikowska, ALesner. Antimicrobial peptides (AMPs) as drug candidates: a patent review (2003–2015). Expert Opinion on Therapeutic Patents. 2016;26(6):689702. 10.1080/13543776.2016.1176149

87 

WBlanshard, KBodley. Koalas. In: LVogelnest, RWoods, editors. Medicine of Australian Mammals. Collingwood, Australia: CSIRO Publishing; 2008.